HORDB

ID: hor006772
Uniprot ID: Q9BEH3
Protein name: Glycoprotein hormones alpha chain
Gene name: CGA
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Family: Glycoprotein hormones subunit alpha family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process; GO:0042699 follicle-stimulating hormone signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence: FPDGEFTMQDCPECKPRENKFFSKPGAPIYQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSLTRVMVMGNVRVENHTQCHCSTCYYHKF
Length: 96
Propeptide: MDYYRKYAAVILVTLSVFLHILHSFPDGEFTMQDCPECKPRENKFFSKPGAPIYQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSLTRVMVMGNVRVENHTQCHCSTCYYHKF
Signal peptide: MDYYRKYAAVILVTLSVFLHILHS
Modification: NA
Glycosylation: T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006772_AF2.pdb

hor006772_ESM.pdb

Mass:	1268443	Formula:	C474H739N133O138S15
Absent amino acids:	W	Common amino acids:	C
pI:	8.57	Basic residues:	16
Polar residues:	37	Hydrophobic residues:	20
Hydrophobicity:	-44.79	Boman Index:	-17853
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	40.52
Instability Index:	4119.9	Extinction Coefficient cystines:	6585
Absorbance 280nm:	69.32

PubMed ID: 11793416
Title: Comparison of chorionic gonadotropin expression in human and macaque (Macaca fascicularis) trophoblasts.
PubMed ID: 10612425
Title: Cloning and expression of cynomolgus monkey (Macaca fascicularis) gonadotropins luteinizing hormone and follicle-stimulating hormone and identification of two polymorphic sites in the luteinizing hormone beta subunit.